Lineage for d6frhb_ (6frh B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. Family b.86.1.2: Intein (protein splicing domain) [51298] (5 proteins)
  6. Protein automated matches [237863] (3 species)
    not a true protein
  7. Species Synechocystis sp. [TaxId:1111708] [363225] (3 PDB entries)
  8. Domain d6frhb_: 6frh B: [363312]
    Other proteins in same PDB: d6frha2
    automated match to d1mi8a_

Details for d6frhb_

PDB Entry: 6frh (more details), 2.03 Å

PDB Description: crystal structure of ssp dnab mini-intein variant m86
PDB Compounds: (B:) Replicative DNA helicase,Replicative DNA helicase

SCOPe Domain Sequences for d6frhb_:

Sequence, based on SEQRES records: (download)

>d6frhb_ b.86.1.2 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mlresgaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlapeieklp
qsdiywdpivsitetgveevfdltvpglrnfvandiivhasieq

Sequence, based on observed residues (ATOM records): (download)

>d6frhb_ b.86.1.2 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mlresgaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklpqsdiywdpivsite
tgveevfdltvpglrnfvandiivhasieq

SCOPe Domain Coordinates for d6frhb_ are not available.

Timeline for d6frhb_:

Domains from other chains:
(mouse over for more information)
d6frha1, d6frha2