SCOPe 2.08: Domain d6erjb_: 6erj B:

Lineage for d6erjb_ (6erj B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Salmonella paratyphi [TaxId:295319] [363246] (1 PDB entry)

8. Domain d6erjb_: 6erj B: [363289]
   automated match to d5lp9a_
   complexed with acy

Details for d6erjb_

PDB Entry: 6erj, 1.69 Å

PDB Description: self-complemented fima subunit from salmonella enterica

PDB Compounds: (B:) Type-1 fimbrial protein, A chain

SCOPe Domain Sequences for d6erjb_:

Sequence; same for both SEQRES and ATOM records:

>d6erjb_ b.2.3.0 (B:) automated matches {Salmonella paratyphi [TaxId: 295319]}
tpvsvsggtihfegklvnaacavstksadqtvtlgqyrtasftaigdttaqvpfsivlnd
cdpkvaataavafsgqadntntnllavssadnsttatgvgieildntssplkpdgatfsa
kqalvegtntlrftarykataaattpgqanadatfimkye

Timeline for d6erjb_:

• d6erjb_ first appeared in SCOPe 2.07