Lineage for d6fhba1 (6fhb A:2-302)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981022Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 2981023Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries)
    Uniprot P53355 2-285
  8. 2981045Domain d6fhba1: 6fhb A:2-302 [363287]
    Other proteins in same PDB: d6fhba2
    automated match to d2x0ga_
    complexed with act, cl, gol, mg, peg; mutant

Details for d6fhba1

PDB Entry: 6fhb (more details), 1.75 Å

PDB Description: death-associated protein kinase 1 (dapk1) catalytic and auto- regulatory domains with s289a and s308e mutations
PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d6fhba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhba1 d.144.1.7 (A:2-302) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkaaavnmekfkkfaa
r

SCOPe Domain Coordinates for d6fhba1:

Click to download the PDB-style file with coordinates for d6fhba1.
(The format of our PDB-style files is described here.)

Timeline for d6fhba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fhba2