![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Death-associated protein kinase, Dap [75560] (1 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries) Uniprot P53355 2-285 |
![]() | Domain d6fhba1: 6fhb A:2-302 [363287] Other proteins in same PDB: d6fhba2 automated match to d2x0ga_ complexed with act, cl, gol, mg, peg; mutant |
PDB Entry: 6fhb (more details), 1.75 Å
SCOPe Domain Sequences for d6fhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fhba1 d.144.1.7 (A:2-302) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkaaavnmekfkkfaa r
Timeline for d6fhba1: