Lineage for d6fhaa_ (6fha A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981022Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 2981023Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries)
    Uniprot P53355 2-285
  8. 2981055Domain d6fhaa_: 6fha A: [363274]
    automated match to d2x0ga_
    mutant

Details for d6fhaa_

PDB Entry: 6fha (more details), 2.3 Å

PDB Description: death-associated protein kinase 1 (dapk1) catalytic and auto- regulatory domains with s289a and s308a mutations
PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d6fhaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhaa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
frqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredier
evsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqi
lngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpef
vapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsn
tsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkaaavnmekfkkfaar

SCOPe Domain Coordinates for d6fhaa_:

Click to download the PDB-style file with coordinates for d6fhaa_.
(The format of our PDB-style files is described here.)

Timeline for d6fhaa_: