Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (21 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [354513] (2 PDB entries) |
Domain d6f8ha_: 6f8h A: [363273] automated match to d4mcxc_ |
PDB Entry: 6f8h (more details), 2 Å
SCOPe Domain Sequences for d6f8ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f8ha_ a.35.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} ngmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicl dttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva
Timeline for d6f8ha_: