SCOPe 2.07: Domain d6f9ka1: 6f9k A:3-107

Lineage for d6f9ka1 (6f9k A:3-107)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein automated matches [254650] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [363102] (4 PDB entries)

8. Domain d6f9ka1: 6f9k A:3-107 [363260]
   Other proteins in same PDB: d6f9ka2
   automated match to d5tm0a_
   complexed with d0q, so4

Details for d6f9ka1

PDB Entry: 6f9k, 1.4 Å

PDB Description: tryptophan repressor trpr from e.coli with 5-methyl-l-tryptophan as ligand

PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d6f9ka1:

Sequence; same for both SEQRES and ATOM records:

>d6f9ka1 a.4.12.1 (A:3-107) automated matches {Escherichia coli [TaxId: 83333]}
qqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveell
rgemsqrelknelgagiatitrgsnslkaapvelrqwleevllks

Timeline for d6f9ka1:

• d6f9ka1 is new in SCOPe 2.07-stable
  
• d6f9ka1 appears in the current release, SCOPe 2.08