Lineage for d6f9ka1 (6f9k A:3-107)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309098Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2309099Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2309138Protein automated matches [254650] (4 species)
    not a true protein
  7. 2309149Species Escherichia coli [TaxId:83333] [363102] (4 PDB entries)
  8. 2309150Domain d6f9ka1: 6f9k A:3-107 [363260]
    Other proteins in same PDB: d6f9ka2
    automated match to d5tm0a_
    complexed with d0q, so4

Details for d6f9ka1

PDB Entry: 6f9k (more details), 1.4 Å

PDB Description: tryptophan repressor trpr from e.coli with 5-methyl-l-tryptophan as ligand
PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d6f9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f9ka1 a.4.12.1 (A:3-107) automated matches {Escherichia coli [TaxId: 83333]}
qqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveell
rgemsqrelknelgagiatitrgsnslkaapvelrqwleevllks

SCOPe Domain Coordinates for d6f9ka1:

Click to download the PDB-style file with coordinates for d6f9ka1.
(The format of our PDB-style files is described here.)

Timeline for d6f9ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6f9ka2