SCOP 1.63: Domain d1hen__: 1hen -

Lineage for d1hen__ (1hen -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (16 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Chicken (Gallus gallus) [TaxId:9031] [53962] (158 PDB entries)

8. Domain d1hen__: 1hen - [36326]
   mutant

Details for d1hen__

PDB Entry: 1hen, 1.8 Å

PDB Description: structural and thermodynamic analysis of compensating mutations within the core of chicken egg white lysozyme

SCOP Domain Sequences for d1hen__:

Sequence; same for both SEQRES and ATOM records:

>d1hen__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1hen__:

• d1hen__ first appeared (with stable ids) in SCOP 1.55
  
• d1hen__ appears in SCOP 1.61
  
• d1hen__ appears in SCOP 1.65
  
• d1hen__ appears in the current release, SCOPe 2.08, called d1hena_