Lineage for d6hp9b_ (6hp9 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (35 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 3063197Domain d6hp9b_: 6hp9 B: [363259]
    Other proteins in same PDB: d6hp9a2
    automated match to d3zosa_
    complexed with gkb

Details for d6hp9b_

PDB Entry: 6hp9 (more details), 1.96 Å

PDB Description: structure of the kinase domain of human ddr1 in complex with a 2- amino-2,3-dihydro-1h-indene-5-carboxamide-based inhibitor
PDB Compounds: (B:) epithelial discoidin domain-containing receptor 1

SCOPe Domain Sequences for d6hp9b_:

Sequence, based on SEQRES records: (download)

>d6hp9b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilrpdat
knarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledka
aegapgdgqaaqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenftiki
adfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlcra
qpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsqlh
rflaeda

Sequence, based on observed residues (ATOM records): (download)

>d6hp9b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdfprsrlrfkeklgegqfgevhlcevdspqdlhpllvavkilrpdatknarndflkevk
imsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledgptisypmllhvaa
qiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnlyagdyyrvqgravlpir
wmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeqvienageffrdqgrqv
ylsrppacpqglyelmlrcwsreseqrppfsqlhrflaeda

SCOPe Domain Coordinates for d6hp9b_:

Click to download the PDB-style file with coordinates for d6hp9b_.
(The format of our PDB-style files is described here.)

Timeline for d6hp9b_:

  • d6hp9b_ is new in SCOPe 2.07-stable