Lineage for d6h16b_ (6h16 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3063192Domain d6h16b_: 6h16 B: [363254]
    automated match to d5ocld_
    complexed with bma, ca, man, nag

Details for d6h16b_

PDB Entry: 6h16 (more details), 2.9 Å

PDB Description: structure of lrp6 p3e3p4e4 in complex with vhh l-p2-d07
PDB Compounds: (B:) vhh l-p2-d07

SCOPe Domain Sequences for d6h16b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h16b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlqesggglvqaggslrlscaasgrtfsiytigwfrqapgkerefvaeitwsggstyy
adsvkgrftisrdnakntvylqmnslkpedtavyycaaitytrgiykywgqgtqvtvss

SCOPe Domain Coordinates for d6h16b_:

Click to download the PDB-style file with coordinates for d6h16b_.
(The format of our PDB-style files is described here.)

Timeline for d6h16b_:

  • d6h16b_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-05