![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
![]() | Protein automated matches [254617] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries) |
![]() | Domain d6fbna3: 6fbn A:252-395 [363251] automated match to d2hj2a3 complexed with edo, k, mg, peg, ppk, sam; mutant |
PDB Entry: 6fbn (more details), 2.7 Å
SCOPe Domain Sequences for d6fbna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fbna3 d.130.1.0 (A:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]} iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy qrtaayghfgrdsfpwevpkklky
Timeline for d6fbna3: