Lineage for d1fn5a_ (1fn5 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129138Species Chicken (Gallus gallus) [TaxId:9031] [53962] (155 PDB entries)
  8. 129181Domain d1fn5a_: 1fn5 A: [36325]

Details for d1fn5a_

PDB Entry: 1fn5 (more details), 1.78 Å

PDB Description: hen egg white lysozyme mutant with alanine substituted for glycine

SCOP Domain Sequences for d1fn5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn5a_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdastdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1fn5a_:

Click to download the PDB-style file with coordinates for d1fn5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fn5a_: