Lineage for d6gs4a_ (6gs4 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633526Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 2633527Superfamily f.38.1: MFS general substrate transporter [103473] (4 families) (S)
  5. 2633567Family f.38.1.0: automated matches [354001] (1 protein)
    not a true family
  6. 2633568Protein automated matches [354002] (2 species)
    not a true protein
  7. 2633569Species Escherichia coli [TaxId:83333] [363239] (1 PDB entry)
  8. 2633570Domain d6gs4a_: 6gs4 A: [363240]
    automated match to d4ikwa_
    complexed with f9e, lmt

Details for d6gs4a_

PDB Entry: 6gs4 (more details), 2.65 Å

PDB Description: crystal structure of peptide transporter dtpa-nanobody in complex with valganciclovir
PDB Compounds: (A:) Dipeptide and tripeptide permease A

SCOPe Domain Sequences for d6gs4a_:

Sequence, based on SEQRES records: (download)

>d6gs4a_ f.38.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
fkqpkafylifsielwerfgyyglqgimavylvkqlgmseadsitlfssfsalvyglvai
ggwlgdkvlgtkrvimlgaivlaigyalvawsghdagivymgmaaiavgnglfkanpssl
lstcyekndprldgaftmyymsvnigsffsmiatpwlaakygwsvafalsvvgllitivn
fafcqrwvkqygskpdfepinyrnllltiigvvaliaiatwllhnqevarmalgvvafgi
vvifgkeafamkgaarrkmivafilmleaiiffvlysqmptslnffairnvehsilglav
epeqyqalnpfwiiigspilaaiynkmgdtlpmptkfaigmvmcsgaflilplgakfasd
agivsvswlvasyglqsigelmisglglamvaqlvpqrlmgfimgswflttaganliggy
vagmmavpdnvtdplmslevygrvflqigvataviavlmlltapklhrmtqd

Sequence, based on observed residues (ATOM records): (download)

>d6gs4a_ f.38.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
fkqpkafylifsielwerfgyyglqgimavylvkqlgmseadsitlfssfsalvyglvai
ggwlgdkvlgtkrvimlgaivlaigyalvawsghdagivymgmaaiavgnglfkanpssl
lstcyedprldgaftmyymsvnigsffsmiatpwlaakygwsvafalsvvgllitivnfa
fcqrwvkqygskpdfepinyrnllltiigvvaliaiatwllhnqevarmalgvvafgivv
ifgkeafamkgaarrkmivafilmleaiiffvlysqmptslnffairnvehsilglavep
eqyqalnpfwiiigspilaaiyngdtlpmptkfaigmvmcsgaflilplgakfasdagiv
svswlvasyglqsigelmisglglamvaqlvpqrlmgfimgswflttaganliggyvagm
mavpdnvtdplmslevygrvflqigvataviavlmlltapklhrmtqd

SCOPe Domain Coordinates for d6gs4a_:

Click to download the PDB-style file with coordinates for d6gs4a_.
(The format of our PDB-style files is described here.)

Timeline for d6gs4a_: