Lineage for d6fi3a_ (6fi3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981976Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2982066Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (58 PDB entries)
  8. 2982081Domain d6fi3a_: 6fi3 A: [363234]
    automated match to d3erka_
    complexed with dj2, dms, so4

Details for d6fi3a_

PDB Entry: 6fi3 (more details), 1.52 Å

PDB Description: crystal structure of erk2 in complex with an adenosine derivative
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d6fi3a_:

Sequence, based on SEQRES records: (download)

>d6fi3a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfq

Sequence, based on observed residues (ATOM records): (download)

>d6fi3a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapfklpkeklkelifeetarfq

SCOPe Domain Coordinates for d6fi3a_:

Click to download the PDB-style file with coordinates for d6fi3a_.
(The format of our PDB-style files is described here.)

Timeline for d6fi3a_: