SCOPe 2.08: Domain d6gcga1: 6gcg A:8-166

Lineage for d6gcga1 (6gcg A:8-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)

8. Domain d6gcga1: 6gcg A:8-166 [363231]
   Other proteins in same PDB: d6gcga2
   automated match to d5i6la1
   complexed with cu

Details for d6gcga1

PDB Entry: 6gcg, 1.8 Å

PDB Description: copper nitrite reductase from achromobacter cycloclastes: large polymorph dataset 15

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6gcga1:

Sequence; same for both SEQRES and ATOM records:

>d6gcga1 b.6.1.0 (A:8-166) automated matches {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d6gcga1:

• d6gcga1 first appeared in SCOPe 2.07