SCOPe 2.08: Domain d6fp6v_: 6fp6 V:

Lineage for d6fp6v_ (6fp6 V:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries)

8. Domain d6fp6v_: 6fp6 V: [363224]
   Other proteins in same PDB: d6fp6a_, d6fp6c_, d6fp6e_, d6fp6g_, d6fp6i_, d6fp6k_, d6fp6m_, d6fp6o_, d6fp6q_, d6fp6s_, d6fp6u_, d6fp6w_
   automated match to d1do5a_
   complexed with gol, ppi, zn

Details for d6fp6v_

PDB Entry: 6fp6, 3 Å

PDB Description: complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation

PDB Compounds: (V:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d6fp6v_:

Sequence, based on SEQRES records:

>d6fp6v_ b.1.8.1 (V:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
ddlgrgghplskitgnsgerlacgiiarsa

Sequence, based on observed residues (ATOM records):

>d6fp6v_ b.1.8.1 (V:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnscgnhf
npdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidegeddlg
rgghplskitgnsgerlacgiiarsa

Timeline for d6fp6v_:

• d6fp6v_ first appeared in SCOPe 2.07