Lineage for d6fp6v_ (6fp6 V:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763710Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)
  7. 2763717Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries)
  8. 2763728Domain d6fp6v_: 6fp6 V: [363224]
    Other proteins in same PDB: d6fp6a_, d6fp6c_, d6fp6e_, d6fp6g_, d6fp6i_, d6fp6k_, d6fp6m_, d6fp6o_, d6fp6q_, d6fp6s_, d6fp6u_, d6fp6w_
    automated match to d1do5a_
    complexed with gol, ppi, zn

Details for d6fp6v_

PDB Entry: 6fp6 (more details), 3 Å

PDB Description: complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation
PDB Compounds: (V:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d6fp6v_:

Sequence, based on SEQRES records: (download)

>d6fp6v_ b.1.8.1 (V:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
ddlgrgghplskitgnsgerlacgiiarsa

Sequence, based on observed residues (ATOM records): (download)

>d6fp6v_ b.1.8.1 (V:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnscgnhf
npdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidegeddlg
rgghplskitgnsgerlacgiiarsa

SCOPe Domain Coordinates for d6fp6v_:

Click to download the PDB-style file with coordinates for d6fp6v_.
(The format of our PDB-style files is described here.)

Timeline for d6fp6v_: