![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries) |
![]() | Domain d6fold_: 6fol D: [363213] Other proteins in same PDB: d6folb_, d6folc_, d6fole2, d6folf_, d6folg_ automated match to d1do5a_ complexed with gol, pe8, zn |
PDB Entry: 6fol (more details), 2.55 Å
SCOPe Domain Sequences for d6fold_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fold_ b.1.8.1 (D:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege ddlgrgghplskitgnsgerlacgiiar
Timeline for d6fold_: