Lineage for d6ff8a_ (6ff8 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. Domain d6ff8a_: 6ff8 A: [363210]
    automated match to d4cz2b_
    complexed with gtp, mg

Details for d6ff8a_

PDB Entry: 6ff8 (more details), 2.13 Å

PDB Description: crystal structure of uncomplexed rab32 in the active gtp-bound state at 2.13 angstrom resolution
PDB Compounds: (A:) ras-related protein rab-32

SCOPe Domain Sequences for d6ff8a_:

Sequence, based on SEQRES records: (download)

>d6ff8a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlql
wdiaglerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspipav
llankcdqnkdssqspsqvdqfckehgfagwfetsakdninieeaarflvekilvnhqs

Sequence, based on observed residues (ATOM records): (download)

>d6ff8a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlql
wdiaglerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspipav
llankcdqsqspsqvdqfckehgfagwfetsakdninieeaarflvekilvnhqs

SCOPe Domain Coordinates for d6ff8a_ are not available.

Timeline for d6ff8a_:

Domains from other chains:
(mouse over for more information)
d6ff8b_