SCOPe 2.07: Domain d6feia_: 6fei A:

Lineage for d6feia_ (6fei A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein automated matches [190258] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [363170] (3 PDB entries)

8. Domain d6feia_: 6fei A: [363203]
   automated match to d1qw7a_
   complexed with d6k, fmt, zn

Details for d6feia_

PDB Entry: 6fei, 1.7 Å

PDB Description: phosphotriesterase pte_a53_1

PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d6feia_:

Sequence; same for both SEQRES and ATOM records:

>d6feia_ c.1.9.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt

Timeline for d6feia_:

• d6feia_ is new in SCOPe 2.07-stable
  
• d6feia_ appears in the current release, SCOPe 2.08