Lineage for d6feia_ (6fei A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2419732Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2419821Protein automated matches [190258] (3 species)
    not a true protein
  7. 3063108Species Escherichia coli [TaxId:562] [363170] (3 PDB entries)
  8. 3063141Domain d6feia_: 6fei A: [363203]
    automated match to d1qw7a_
    complexed with d6k, fmt, zn

Details for d6feia_

PDB Entry: 6fei (more details), 1.7 Å

PDB Description: phosphotriesterase pte_a53_1
PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d6feia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6feia_ c.1.9.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt

SCOPe Domain Coordinates for d6feia_:

Click to download the PDB-style file with coordinates for d6feia_.
(The format of our PDB-style files is described here.)

Timeline for d6feia_:

  • d6feia_ is new in SCOPe 2.07-stable