Lineage for d6ffga1 (6ffg A:344-455)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (14 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 3063129Domain d6ffga1: 6ffg A:344-455 [363191]
    Other proteins in same PDB: d6ffga2
    automated match to d4qeua_
    complexed with d7b, edo, mes, peg

Details for d6ffga1

PDB Entry: 6ffg (more details), 1.59 Å

PDB Description: human brd2 c-terminal bromodomain with (s)-1-(2-cyclopropyl-4-(2- (hydroxymethyl)benzyl)-6-(1,2,3,6-tetrahydropyridin-4-yl)-3,4- dihydroquinoxalin-1(2h)-yl)ethanone
PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d6ffga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ffga1 a.29.2.0 (A:344-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

SCOPe Domain Coordinates for d6ffga1:

Click to download the PDB-style file with coordinates for d6ffga1.
(The format of our PDB-style files is described here.)

Timeline for d6ffga1:

  • d6ffga1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ffga2