![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
![]() | Protein automated matches [190907] (17 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [354513] (2 PDB entries) |
![]() | Domain d6f8hc_: 6f8h C: [363190] automated match to d4mcxc_ |
PDB Entry: 6f8h (more details), 2 Å
SCOPe Domain Sequences for d6f8hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f8hc_ a.35.1.0 (C:) automated matches {Pseudomonas putida [TaxId: 303]} gmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicld ttpefwlnlqtafdlrtaeqqhgdeiigsvqrl
Timeline for d6f8hc_: