SCOPe 2.08: Domain d6fn8b_: 6fn8 B:

Lineage for d6fn8b_ (6fn8 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries)

8. Domain d6fn8b_: 6fn8 B: [363188]
   automated match to d1do5a_
   complexed with zn

Details for d6fn8b_

PDB Entry: 6fn8, 1.55 Å

PDB Description: domain ii of the human copper chaperone for superoxide dismutase at 1.55 a resolution

PDB Compounds: (B:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d6fn8b_:

Sequence; same for both SEQRES and ATOM records:

>d6fn8b_ b.1.8.1 (B:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
ddlgrgghplskitgnsgerlacgiiarsagl

Timeline for d6fn8b_:

• d6fn8b_ first appeared in SCOPe 2.07