![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily) barrel, closed; n=8, S=10; one overside connection |
![]() | Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) ![]() automatically mapped to Pfam PF03734 |
![]() | Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins) Pfam PF03734; ErfK/YbiS/YcfS/YnhG |
![]() | Protein automated matches [234004] (6 species) not a true protein |
![]() | Species Enterococcus faecium [TaxId:1352] [363176] (1 PDB entry) |
![]() | Domain d6fj1a2: 6fj1 A:341-466 [363177] Other proteins in same PDB: d6fj1a1, d6fj1a3, d6fj1a4, d6fj1b1, d6fj1b3, d6fj1b4, d6fj1c1, d6fj1c3, d6fj1c4 automated match to d1zata1 complexed with cl, gol, nxl, p3g |
PDB Entry: 6fj1 (more details), 2.69 Å
SCOPe Domain Sequences for d6fj1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fj1a2 b.160.1.1 (A:341-466) automated matches {Enterococcus faecium [TaxId: 1352]} liedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgtng tpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgmvekg tpvlvf
Timeline for d6fj1a2: