Lineage for d6fj1a2 (6fj1 A:341-466)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825385Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2825386Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2825387Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2825409Protein automated matches [234004] (6 species)
    not a true protein
  7. 2825425Species Enterococcus faecium [TaxId:1352] [363176] (1 PDB entry)
  8. 2825426Domain d6fj1a2: 6fj1 A:341-466 [363177]
    Other proteins in same PDB: d6fj1a1, d6fj1a3, d6fj1a4, d6fj1b1, d6fj1b3, d6fj1b4, d6fj1c1, d6fj1c3, d6fj1c4
    automated match to d1zata1
    complexed with cl, gol, nxl, p3g

Details for d6fj1a2

PDB Entry: 6fj1 (more details), 2.69 Å

PDB Description: structure of the ldtfm-avibactam carbamoyl enzyme
PDB Compounds: (A:) L,D-transpeptidase

SCOPe Domain Sequences for d6fj1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fj1a2 b.160.1.1 (A:341-466) automated matches {Enterococcus faecium [TaxId: 1352]}
liedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgtng
tpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgmvekg
tpvlvf

SCOPe Domain Coordinates for d6fj1a2:

Click to download the PDB-style file with coordinates for d6fj1a2.
(The format of our PDB-style files is described here.)

Timeline for d6fj1a2: