![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily) unusual fold, made of four helices and four 2-3 stranded beta-sheets |
![]() | Superfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) ![]() automatically mapped to Pfam PF12229 |
![]() | Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (2 proteins) |
![]() | Protein automated matches [363173] (1 species) not a true protein |
![]() | Species Enterococcus faecium [TaxId:1352] [363174] (1 PDB entry) |
![]() | Domain d6fj1a1: 6fj1 A:218-340 [363175] Other proteins in same PDB: d6fj1a2, d6fj1a3, d6fj1a4, d6fj1b2, d6fj1b3, d6fj1b4, d6fj1c2, d6fj1c3, d6fj1c4 automated match to d1zata2 complexed with cl, gol, nxl, p3g |
PDB Entry: 6fj1 (more details), 2.69 Å
SCOPe Domain Sequences for d6fj1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fj1a1 d.335.1.1 (A:218-340) automated matches {Enterococcus faecium [TaxId: 1352]} lkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtk yntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtta dhp
Timeline for d6fj1a1: