Lineage for d6fj1a1 (6fj1 A:218-340)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011195Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily)
    unusual fold, made of four helices and four 2-3 stranded beta-sheets
  4. 3011196Superfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) (S)
    automatically mapped to Pfam PF12229
  5. 3011197Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (2 proteins)
  6. 3011204Protein automated matches [363173] (1 species)
    not a true protein
  7. 3011205Species Enterococcus faecium [TaxId:1352] [363174] (1 PDB entry)
  8. 3011206Domain d6fj1a1: 6fj1 A:218-340 [363175]
    Other proteins in same PDB: d6fj1a2, d6fj1a3, d6fj1a4, d6fj1b2, d6fj1b3, d6fj1b4, d6fj1c2, d6fj1c3, d6fj1c4
    automated match to d1zata2
    complexed with cl, gol, nxl, p3g

Details for d6fj1a1

PDB Entry: 6fj1 (more details), 2.69 Å

PDB Description: structure of the ldtfm-avibactam carbamoyl enzyme
PDB Compounds: (A:) L,D-transpeptidase

SCOPe Domain Sequences for d6fj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fj1a1 d.335.1.1 (A:218-340) automated matches {Enterococcus faecium [TaxId: 1352]}
lkeqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtk
yntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggtta
dhp

SCOPe Domain Coordinates for d6fj1a1:

Click to download the PDB-style file with coordinates for d6fj1a1.
(The format of our PDB-style files is described here.)

Timeline for d6fj1a1: