![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
![]() | Protein automated matches [190258] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [363170] (3 PDB entries) |
![]() | Domain d6feib_: 6fei B: [363171] automated match to d1qw7a_ complexed with d6k, fmt, zn |
PDB Entry: 6fei (more details), 1.7 Å
SCOPe Domain Sequences for d6feib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6feib_ c.1.9.3 (B:) automated matches {Escherichia coli [TaxId: 562]} isefigdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglr raraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltq fflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrd geqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasa sallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafi plrvipflrekgvpqetlagitvtnparflsptlras
Timeline for d6feib_: