Lineage for d6fffa1 (6fff A:344-455)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. Domain d6fffa1: 6fff A:344-455 [363146]
    Other proteins in same PDB: d6fffa2
    automated match to d4qeua_
    complexed with d7h, edo, mes

Details for d6fffa1

PDB Entry: 6fff (more details), 1.6700000000000002 Å

PDB Description: human brd2 c-terminal bromodomain with (s)-5-(1-acetyl-2-cyclopropyl- 4-(2-(hydroxymethyl)benzyl)-1,2,3,4-tetrahydroquinoxalin-6-yl) pyrimidine-2-carboxamide
PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d6fffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fffa1 a.29.2.0 (A:344-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

SCOPe Domain Coordinates for d6fffa1 are not available.

Timeline for d6fffa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fffa2