SCOPe 2.08: Domain d6fffa1: 6fff A:344-455

Lineage for d6fffa1 (6fff A:344-455)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d6fffa1: 6fff A:344-455 [363146]
   Other proteins in same PDB: d6fffa2
   automated match to d4qeua_
   complexed with d7h, edo, mes

Details for d6fffa1

PDB Entry: 6fff, 1.67 Å

PDB Description: human brd2 c-terminal bromodomain with (s)-5-(1-acetyl-2-cyclopropyl- 4-(2-(hydroxymethyl)benzyl)-1,2,3,4-tetrahydroquinoxalin-6-yl) pyrimidine-2-carboxamide

PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d6fffa1:

Sequence; same for both SEQRES and ATOM records:

>d6fffa1 a.29.2.0 (A:344-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

Timeline for d6fffa1:

• d6fffa1 first appeared in SCOPe 2.07