Lineage for d6fbpb2 (6fbp B:132-251)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539659Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2539660Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2539765Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2539766Protein automated matches [254617] (15 species)
    not a true protein
  7. 2539803Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 3063080Domain d6fbpb2: 6fbp B:132-251 [363142]
    automated match to d2hj2a2
    complexed with act, adn, edo, k, mg, pg4, ppk; mutant

Details for d6fbpb2

PDB Entry: 6fbp (more details), 1.65 Å

PDB Description: human methionine adenosyltransferase ii mutant (s114a) in p22121 crystal form
PDB Compounds: (B:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d6fbpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fbpb2 d.130.1.0 (B:132-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqd
rgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrfv

SCOPe Domain Coordinates for d6fbpb2:

Click to download the PDB-style file with coordinates for d6fbpb2.
(The format of our PDB-style files is described here.)

Timeline for d6fbpb2:

  • d6fbpb2 is new in SCOPe 2.07-stable