Lineage for d6fbpa3 (6fbp A:252-395)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. Protein automated matches [254617] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. Domain d6fbpa3: 6fbp A:252-395 [363138]
    automated match to d2hj2a3
    complexed with act, adn, edo, k, mg, pg4, ppk; mutant

Details for d6fbpa3

PDB Entry: 6fbp (more details), 1.6500000000000001 Å

PDB Description: human methionine adenosyltransferase ii mutant (s114a) in p22121 crystal form
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d6fbpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fbpa3 d.130.1.0 (A:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc
rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy
qrtaayghfgrdsfpwevpkklky

SCOPe Domain Coordinates for d6fbpa3 are not available.

Timeline for d6fbpa3:

Domains from same chain:
(mouse over for more information)
d6fbpa1, d6fbpa2
Domains from other chains:
(mouse over for more information)
d6fbpb1, d6fbpb2, d6fbpb3