SCOPe 2.08: Domain d6falb1: 6fal B:13-108

Lineage for d6falb1 (6fal B:13-108)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein automated matches [254650] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [340663] (7 PDB entries)

8. Domain d6falb1: 6fal B:13-108 [363131]
   Other proteins in same PDB: d6falb2
   automated match to d5tm0a_
   complexed with iop

Details for d6falb1

PDB Entry: 6fal, 1.2 Å

PDB Description: tryptophan repressor trpr from e.coli with 3-indolepropionic acid as ligand

PDB Compounds: (B:) trp operon repressor

SCOPe Domain Sequences for d6falb1:

Sequence; same for both SEQRES and ATOM records:

>d6falb1 a.4.12.1 (B:13-108) automated matches {Escherichia coli [TaxId: 83334]}
eqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgemsqrelk
nelgagiatitrgsnylkaapvelrqwleevllksd

Timeline for d6falb1:

• d6falb1 first appeared in SCOPe 2.07