Lineage for d6fcmc1 (6fcm C:1-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583903Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)
  8. 2583928Domain d6fcmc1: 6fcm C:1-126 [363129]
    automated match to d1plqa1

Details for d6fcmc1

PDB Entry: 6fcm (more details), 2.8 Å

PDB Description: crystal structure of human pcna
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6fcmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fcmc1 d.131.1.0 (C:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d6fcmc1:

Click to download the PDB-style file with coordinates for d6fcmc1.
(The format of our PDB-style files is described here.)

Timeline for d6fcmc1: