Lineage for d6e8yb2 (6e8y B:194-349)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721675Domain d6e8yb2: 6e8y B:194-349 [363095]
    Other proteins in same PDB: d6e8ya1, d6e8yb1
    automated match to d1x0va2
    complexed with 3sy, k, po4

Details for d6e8yb2

PDB Entry: 6e8y (more details), 1.85 Å

PDB Description: unliganded human glycerol 3-phosphate dehydrogenase
PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic

SCOPe Domain Sequences for d6e8yb2:

Sequence, based on SEQRES records: (download)

>d6e8yb2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk
glvdkfplfmavykvcyegqpvgefihclqnhpehm

Sequence, based on observed residues (ATOM records): (download)

>d6e8yb2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellnklqgpetarelysilqhkgl
vdkfplfmavykvcyegqpvgefihclqnhpehm

SCOPe Domain Coordinates for d6e8yb2:

Click to download the PDB-style file with coordinates for d6e8yb2.
(The format of our PDB-style files is described here.)

Timeline for d6e8yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e8yb1