SCOPe 2.07: Domain d6c6ha1: 6c6h A:7-185

Lineage for d6c6ha1 (6c6h A:7-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6c6ha1: 6c6h A:7-185 [363059]
   Other proteins in same PDB: d6c6ha2, d6c6hb_
   automated match to d1zt4c2
   complexed with bma, elg, fuc, man, nag, plm

Details for d6c6ha1

PDB Entry: 6c6h, 2 Å

PDB Description: structure of glycolipid agsa[8,p5m] in complex with mouse cd1d

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6c6ha1:

Sequence; same for both SEQRES and ATOM records:

>d6c6ha1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6c6ha1:

• d6c6ha1 is new in SCOPe 2.07-stable
  
• d6c6ha1 appears in the current release, SCOPe 2.08