Lineage for d6c68a1 (6c68 A:1-115)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d6c68a1: 6c68 A:1-115 [363053]
    Other proteins in same PDB: d6c68a2, d6c68b2, d6c68c2, d6c68d2
    automated match to d3reva1

Details for d6c68a1

PDB Entry: 6c68 (more details), 2.59 Å

PDB Description: mhc-independent t cell receptor a11
PDB Compounds: (A:) T-cell receptor alpha chain

SCOPe Domain Sequences for d6c68a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c68a1 b.1.1.0 (A:1-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqteglvtvteglpvmlnctyqtaysdvaffwyvqylneapklllrsstdnkrtehq
gfhatlhkssssfhlqkssvqlsdsalyycalsphntgnykyvfgagtrlkviah

SCOPe Domain Coordinates for d6c68a1 are not available.

Timeline for d6c68a1:

Domains from same chain:
(mouse over for more information)
d6c68a2
Domains from other chains:
(mouse over for more information)
d6c68b1, d6c68b2, d6c68c1, d6c68c2, d6c68d1, d6c68d2