SCOPe 2.03: Domain d1a2yc_: 1a2y C:

Lineage for d1a2yc_ (1a2y C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Chicken (Gallus gallus) [TaxId:9031] [53962] (457 PDB entries)
   Uniprot P00698

8. Domain d1a2yc_: 1a2y C: [36305]
   Other proteins in same PDB: d1a2ya_, d1a2yb_
   complexed with po4; mutant

Details for d1a2yc_

PDB Entry: 1a2y, 1.5 Å

PDB Description: hen egg white lysozyme, d18a mutant, in complex with mouse monoclonal antibody d1.3

PDB Compounds: (C:) lysozyme

SCOPe Domain Sequences for d1a2yc_:

Sequence; same for both SEQRES and ATOM records:

>d1a2yc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhglanyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1a2yc_:

• d1a2yc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a2yc_ appears in SCOPe 2.02
  
• d1a2yc_ appears in SCOPe 2.04
  
• d1a2yc_ appears in the current release, SCOPe 2.08