Lineage for d6a79i_ (6a79 I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356591Domain d6a79i_: 6a79 I: [363042]
    Other proteins in same PDB: d6a79a1, d6a79a2, d6a79b1, d6a79b2
    automated match to d1ar1c_
    complexed with so4; mutant

Details for d6a79i_

PDB Entry: 6a79 (more details), 2.31 Å

PDB Description: crystal structure of the fifth immunoglobulin domain (ig5) of human robo1 in complex with the mutant scfv fragment (p103a) of murine monoclonal antibody b5209b
PDB Compounds: (I:) Heavy chain of the anti-human Robo1 antibody B5209B scFv

SCOPe Domain Sequences for d6a79i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a79i_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
pdsvkgrftssrdnaknilylqmsslksedtamyycareallrpayyaldywgqgtsvtv
ss

SCOPe Domain Coordinates for d6a79i_:

Click to download the PDB-style file with coordinates for d6a79i_.
(The format of our PDB-style files is described here.)

Timeline for d6a79i_: