Lineage for d6q90a1 (6q90 A:2-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930509Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2930576Protein automated matches [232306] (2 species)
    not a true protein
  7. 2930577Species Human (Homo sapiens) [TaxId:9606] [362871] (16 PDB entries)
  8. 2930612Domain d6q90a1: 6q90 A:2-216 [363003]
    Other proteins in same PDB: d6q90a2, d6q90a3, d6q90b2, d6q90c2, d6q90c3, d6q90d2
    automated match to d1wuua1
    complexed with gal, hfk, jhj

Details for d6q90a1

PDB Entry: 6q90 (more details), 2.4 Å

PDB Description: structure of human galactokinase 1 bound with 1-(4-methoxyphenyl)-3- (4-pyridinyl)urea
PDB Compounds: (A:) Galactokinase

SCOPe Domain Sequences for d6q90a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q90a1 d.14.1.5 (A:2-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt
vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap
lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp
cgimdqfislmgqkghallidcrsletslvplsdp

SCOPe Domain Coordinates for d6q90a1:

Click to download the PDB-style file with coordinates for d6q90a1.
(The format of our PDB-style files is described here.)

Timeline for d6q90a1: