Lineage for d5z6ha_ (5z6h A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335388Family a.102.1.9: Trehalase-like [158742] (2 proteins)
    Pham PF01204
    automatically mapped to Pfam PF01204
  6. 2335392Protein automated matches [190737] (2 species)
    not a true protein
  7. 2335393Species Enterobacter cloacae [TaxId:550] [362966] (2 PDB entries)
  8. 2335395Domain d5z6ha_: 5z6h A: [362976]
    automated match to d2jf4a1
    complexed with gol, so4

Details for d5z6ha_

PDB Entry: 5z6h (more details), 2.3 Å

PDB Description: structure of periplasmic trehalase from diamondback moth gut bacteria in the apo form
PDB Compounds: (A:) periplasmic trehalase

SCOPe Domain Sequences for d5z6ha_:

Sequence, based on SEQRES records: (download)

>d5z6ha_ a.102.1.9 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
qttspdillgplfndvqsaklfpdqktfadavpksdplmiladyrmqhtqssfdlrhfve
mnftlpaegekyvppagqslrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfr
evyywdsyftmlglaesdhwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmm
vellathdsdalkkyrpqmekeyaywmdgvdalqpgqankrvvklddgailnrywddrdt
prpeswlddvntaksnpnrpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpv
dlnalmfkmekllarasqesgdaasaskyealatarqkaieshlwndkegwyadydlksk
kvrnqltaaalfplyvkaaaqdradkvaaatssrllkpggiatttvnsgqqwdapngwap
lqwvaaeglqnygqekvsmdvtwrflknvqhtydrekklvekydvsttgtgggggeyplq
dgfgwsngvtlkmldrvcpkakpcdsvpenqp

Sequence, based on observed residues (ATOM records): (download)

>d5z6ha_ a.102.1.9 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
qttspdillgplfndvqsaklfpdqktfadavpksdplmiladyrmqhdlrhfvemnftl
paegekyvppagqslrehiddlwpvltrttdkasnkwdsllplpkpyvvpggrfrevyyw
dsyftmlglaesdhwdkisdmvdnfayeidtfghipngnrsyylsrsqppffsmmvella
thdsdalkkyrpqmekeyaywmdgvdalqpgqankrvvklddgailnrywddrdtprpes
wlddvntaksnpnrpateiyrdlrsaaasgwdfssrwmddpqklgtirttsivpvdlnal
mfkmekllarasqesgdaasaskyealatarqkaieshlwndkegwyadydlkskkvrnq
ltaaalfplyvkaaaqdradkvaaatssrllkpggiatttvnsgqqwdapngwaplqwva
aeglqnygqekvsmdvtwrflknvqhtydrekklvekydvsttgtgggeyplqdgfgwsn
gvtlkmldrvcpkakpcdsvpenqp

SCOPe Domain Coordinates for d5z6ha_:

Click to download the PDB-style file with coordinates for d5z6ha_.
(The format of our PDB-style files is described here.)

Timeline for d5z6ha_: