![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein Galectin-3 CRD [49940] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49941] (85 PDB entries) |
![]() | Domain d6i77a_: 6i77 A: [362963] automated match to d3zsja_ complexed with h5q |
PDB Entry: 6i77 (more details), 1.22 Å
SCOPe Domain Sequences for d6i77a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i77a_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} plivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis klgisgdidltsasytmi
Timeline for d6i77a_: