Lineage for d5w7ha_ (5w7h A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442120Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2442121Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. 2442232Species Rhizobium radiobacter [TaxId:358] [362917] (1 PDB entry)
  8. 2442233Domain d5w7ha_: 5w7h A: [362936]
    automated match to d3e3ha_
    complexed with zn

Details for d5w7ha_

PDB Entry: 5w7h (more details), 2.75 Å

PDB Description: supercharged arpte variant r5
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d5w7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w7ha_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Rhizobium radiobacter [TaxId: 358]}
gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalvekavrglrharaa
gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltrfflre
irhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsgsqrdgeqqa
aifeseglspsrvcighsddtddlryltglaargylvgldrmpysaiglrgnasalalfg
trswqtrallikalidrgykdrilvshdwlfgfssyvtnimrvmdrinpdgmafvplrvi
pflrekgvppetlagvtvanparflsptv

SCOPe Domain Coordinates for d5w7ha_:

Click to download the PDB-style file with coordinates for d5w7ha_.
(The format of our PDB-style files is described here.)

Timeline for d5w7ha_: