Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
Protein automated matches [190060] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries) |
Domain d6ndfr_: 6ndf R: [362934] Other proteins in same PDB: d6ndfa_, d6ndfb_, d6ndfd_, d6ndfe_, d6ndfg_, d6ndfh_, d6ndfj_, d6ndfk_, d6ndfm_, d6ndfn_, d6ndfp_, d6ndfq_ automated match to d1aoxb_ complexed with cl, na, nh4, so4, sr |
PDB Entry: 6ndf (more details), 3.05 Å
SCOPe Domain Sequences for d6ndfr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndfr_ c.62.1.1 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall ekagtlgeqif
Timeline for d6ndfr_: