Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (16 species) ubiquitous in a variety of tussues ans secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (158 PDB entries) |
Domain d4lyz__: 4lyz - [36290] |
PDB Entry: 4lyz (more details), 2 Å
SCOP Domain Sequences for d4lyz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lyz__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d4lyz__: