Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (187 PDB entries) |
Domain d1fdly_: 1fdl Y: [36288] Other proteins in same PDB: d1fdlh1, d1fdlh2, d1fdll1, d1fdll2 |
PDB Entry: 1fdl (more details), 2.5 Å
SCOP Domain Sequences for d1fdly_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdly_ d.2.1.2 (Y:) Lysozyme {Chicken (Gallus gallus)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1fdly_:
View in 3D Domains from other chains: (mouse over for more information) d1fdlh1, d1fdlh2, d1fdll1, d1fdll2 |