Lineage for d6ndfh_ (6ndf H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001815Protein automated matches [190329] (10 species)
    not a true protein
  7. 3001878Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries)
  8. 3001953Domain d6ndfh_: 6ndf H: [362848]
    Other proteins in same PDB: d6ndfc_, d6ndff_, d6ndfi_, d6ndfl_, d6ndfo_, d6ndfr_
    automated match to d1v7pb_
    complexed with cl, na, nh4, so4, sr

Details for d6ndfh_

PDB Entry: 6ndf (more details), 3.05 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain with strontium
PDB Compounds: (H:) Snaclec rhodocetin subunit delta

SCOPe Domain Sequences for d6ndfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndfh_ d.169.1.1 (H:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
kf

SCOPe Domain Coordinates for d6ndfh_:

Click to download the PDB-style file with coordinates for d6ndfh_.
(The format of our PDB-style files is described here.)

Timeline for d6ndfh_: