| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (10 species) not a true protein |
| Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries) |
| Domain d6ndgd_: 6ndg D: [362840] Other proteins in same PDB: d6ndgc_, d6ndgf_, d6ndgi_, d6ndgl_, d6ndgo_, d6ndgr_ automated match to d1v4la_ complexed with cl, na, nh4, so4, y1 |
PDB Entry: 6ndg (more details), 3.15 Å
SCOPe Domain Sequences for d6ndgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndgd_ d.169.1.1 (D:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
aknpfvckfps
Timeline for d6ndgd_: