SCOPe 2.08: Domain d6mgkb2: 6mgk B:408-745

Lineage for d6mgkb2 (6mgk B:408-745)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.0: automated matches [227242] (1 protein)
   not a true family

6. Protein automated matches [227008] (11 species)
   not a true protein

7. Species Paenibacillus odorifer [TaxId:189426] [362770] (3 PDB entries)

8. Domain d6mgkb2: 6mgk B:408-745 [362819]
   Other proteins in same PDB: d6mgka3, d6mgkb3, d6mgkc3, d6mgkd3
   automated match to d4lgna2
   complexed with cl, gol, pe3

Details for d6mgkb2

PDB Entry: 6mgk, 2.1 Å

PDB Description: crystal structure of the catalytic domain from gh74 enzyme pogh74 from paenibacillus odorifer, in complex with xlx xyloglucan

PDB Compounds: (B:) xyloglucanase

SCOPe Domain Sequences for d6mgkb2:

Sequence; same for both SEQRES and ATOM records:

>d6mgkb2 b.69.13.0 (B:408-745) automated matches {Paenibacillus odorifer [TaxId: 189426]}
gkvnisvmakgveetavlglispptgtshlitalgdvsgfrhedlsvaptkfqtspswat
tmsidyaelspsymvrvgsadkektpsmksigisndggvnwympnsepsngtkttvghgq
vavsasgnsilwstsdigvyysktsgnswtasaglpagakiasdrvnpnkyygfyagtfy
vsvdggatftatgasgfptnnvaglqpneaqismkavpgiegdiwfaggntvenkyglwh
stnsgasftkltnveeadligygkaapgqtymslytvakidgvrgvfrsddvgatwvrin
ddahqyakinmaitgdpriygrvylgtngrgtlyadpv

Timeline for d6mgkb2:

• d6mgkb2 first appeared in SCOPe 2.07