Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378) |
Family b.69.13.0: automated matches [227242] (1 protein) not a true family |
Protein automated matches [227008] (11 species) not a true protein |
Species Paenibacillus odorifer [TaxId:189426] [362770] (3 PDB entries) |
Domain d6mgkb2: 6mgk B:408-745 [362819] Other proteins in same PDB: d6mgka3, d6mgkb3, d6mgkc3, d6mgkd3 automated match to d4lgna2 complexed with cl, gol, pe3 |
PDB Entry: 6mgk (more details), 2.1 Å
SCOPe Domain Sequences for d6mgkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mgkb2 b.69.13.0 (B:408-745) automated matches {Paenibacillus odorifer [TaxId: 189426]} gkvnisvmakgveetavlglispptgtshlitalgdvsgfrhedlsvaptkfqtspswat tmsidyaelspsymvrvgsadkektpsmksigisndggvnwympnsepsngtkttvghgq vavsasgnsilwstsdigvyysktsgnswtasaglpagakiasdrvnpnkyygfyagtfy vsvdggatftatgasgfptnnvaglqpneaqismkavpgiegdiwfaggntvenkyglwh stnsgasftkltnveeadligygkaapgqtymslytvakidgvrgvfrsddvgatwvrin ddahqyakinmaitgdpriygrvylgtngrgtlyadpv
Timeline for d6mgkb2: