Lineage for d6h1fb_ (6h1f B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576230Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2576247Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2576290Domain d6h1fb_: 6h1f B: [362815]
    Other proteins in same PDB: d6h1fa1, d6h1fa2
    automated match to d1kcqa_
    complexed with scn

Details for d6h1fb_

PDB Entry: 6h1f (more details), 1.9 Å

PDB Description: structure of the nanobody-stabilized gelsolin d187n variant (second domain)
PDB Compounds: (B:) gelsolin

SCOPe Domain Sequences for d6h1fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h1fb_ d.109.1.1 (B:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vvvqrlfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnryerlkatqv
skgirdnersgrarvhvseegtepeamlqvlgpkpalpagte

SCOPe Domain Coordinates for d6h1fb_:

Click to download the PDB-style file with coordinates for d6h1fb_.
(The format of our PDB-style files is described here.)

Timeline for d6h1fb_: