SCOPe 2.08: Domain d6d7gd2: 6d7g D:117-201

Lineage for d6d7gd2 (6d7g D:117-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6d7gd2: 6d7g D:117-201 [362758]
   Other proteins in same PDB: d6d7ge2
   automated match to d1hxma2
   complexed with nag

Details for d6d7gd2

PDB Entry: 6d7g, 2.75 Å

PDB Description: structure of 5f3 tcr in complex with hla-a2/mart-1

PDB Compounds: (D:) TRA@ protein

SCOPe Domain Sequences for d6d7gd2:

Sequence, based on SEQRES records:

>d6d7gd2 b.1.1.0 (D:117-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
gkyedsnsvtcsvqhdnktvhstdf

Sequence, based on observed residues (ATOM records):

>d6d7gd2 b.1.1.0 (D:117-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqphtkpsvfvmkngtnvaclvkefypkdirinlvsitefdpaivispsgkynavklgky
edsnsvtcsvqhdnktvhstdf

Timeline for d6d7gd2:

• d6d7gd2 first appeared in SCOPe 2.07