Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
Domain d6dj9h_: 6dj9 H: [362731] Other proteins in same PDB: d6dj9a_, d6dj9b_, d6dj9c_, d6dj9d_, d6dj9e_, d6dj9f_ automated match to d4kskc_ |
PDB Entry: 6dj9 (more details), 3.1 Å
SCOPe Domain Sequences for d6dj9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dj9h_ d.15.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls dyniqkesglqlhrrlrp
Timeline for d6dj9h_: