Lineage for d6dj9h_ (6dj9 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932631Domain d6dj9h_: 6dj9 H: [362731]
    Other proteins in same PDB: d6dj9a_, d6dj9b_, d6dj9c_, d6dj9d_, d6dj9e_, d6dj9f_
    automated match to d4kskc_

Details for d6dj9h_

PDB Entry: 6dj9 (more details), 3.1 Å

PDB Description: structure of the usp15 dusp domain in complex with a high-affinity ubiquitin variant (ubv)
PDB Compounds: (H:) Ubiquitin Variant UbV 15.D

SCOPe Domain Sequences for d6dj9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dj9h_ d.15.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
dyniqkesglqlhrrlrp

SCOPe Domain Coordinates for d6dj9h_:

Click to download the PDB-style file with coordinates for d6dj9h_.
(The format of our PDB-style files is described here.)

Timeline for d6dj9h_: