SCOPe 2.08: Domain d6h70c1: 6h70 C:6-126

Lineage for d6h70c1 (6h70 C:6-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d6h70c1: 6h70 C:6-126 [362713]
   Other proteins in same PDB: d6h70c2, d6h70d2
   automated match to d1mqkh_
   complexed with edo, na

Details for d6h70c1

PDB Entry: 6h70, 1.83 Å

PDB Description: gi.1 human norovirus protruding domain in complex with nano-62 and 2- fucosyllactose (2fl)

PDB Compounds: (C:) Nanobody (VHH) Nano-62

SCOPe Domain Sequences for d6h70c1:

Sequence; same for both SEQRES and ATOM records:

>d6h70c1 b.1.1.0 (C:6-126) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvmtggslrlscavsgrtidvsvmawfrqapgkerefvsgmrwsgmttysadsvk
drftisrdktkntvylqmnslkpedtavyycaarsrfivgvpqardlydywgqgtqvtvs
s

Timeline for d6h70c1:

• d6h70c1 first appeared in SCOPe 2.07